PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG222200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 756aa    MW: 80615.9 Da    PI: 6.8172
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG222200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.94.5e-1283787541374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn............sseel 78 
                          lv+lLl+cA++vs+gd+  a + L  l+  asp gd+mqR+a+yf+ ALaarl+ s++  +++ +  +t++              s ++l
  Pavir.8NG222200.1.p 378 LVHLLLACADFVSKGDQPSALRHLHLLRRVASPLGDSMQRVASYFADALAARLSLSSNPSSSSSSGAATPRGGagagvapytfppSPDTL 467
                          68***************************************************99555555554444444333578899999999999** PP

                 GRAS  79 aalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168
                          ++++++++++P++kf+h+taNqaI ea++ge+rvH++D+di qG QWpa+lqaLa+Rp+gpp+lR+Tgvg+     + +++etg+ La++
  Pavir.8NG222200.1.p 468 KIYQILYQACPYVKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQALAARPGGPPTLRLTGVGH----PAAAVRETGRHLASL 553
                          ***********************************************************************....88************* PP

                 GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                          A++l+vpfef++ va+rle l++ +L+ + gEalaVn v +lhr++   v+l      +L+++++  Pk++++veqea hn++ Fl rfl
  Pavir.8NG222200.1.p 554 AASLRVPFEFHAAVADRLERLRPAALQRRVGEALAVNAVNRLHRVP--GVHLGP----LLSMIRDQAPKIMTLVEQEAGHNGPYFLGRFL 637
                          *********************************************9..666666....******************************** PP

                 GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sd 347
                          eal+yysa+fdsl+a++p++s  r kvE+ ll++ei+nvvacegaer++rhe+l +Wr+ +e  GF+pvpls  a+ q + ll  ++ +d
  Pavir.8NG222200.1.p 638 EALHYYSAIFDSLDATFPADSAPRLKVEQCLLAPEIRNVVACEGAERIARHERLDRWRRLMEGRGFEPVPLSPAAVGQSQVLLGLYGaGD 727
                          ****************************************************************************************** PP

                 GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                          gyr+ e++g+l+lgW+dr+++++SaWr
  Pavir.8NG222200.1.p 728 GYRLTEDKGCLLLGWQDRAIIAASAWR 754
                          **************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.014352733IPR005202Transcription factor GRAS
PfamPF035141.6E-125378754IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
MCSSMGMLNC ADTSSGAKLQ QQQAPTSPTA SVSESNIVVS STDPDANDAL AGLQALKFDG  60
DIDVEIQSPD IAMWESLFAE HMGASGSDFL TFSPSREFMA TGSPRRDFMV SSPKRDYMVS  120
SPKRDYMMSS PKRDYMLSSP KREYMVTSPR RDSSPRRSTF SNLYSAGSHQ QAYVHGVHGA  180
EGGGGASQPL YGGLANHGKG KSQSPLHKVY INNAHSNHSG NKSNGPSSLS CSSSYGHVEN  240
LPLPSMDPFL NDGGYLAGYQ LPGKPVLQSG AASATVTTVA PSSQLPTLSE CLAMPEPVYG  300
GAEEAVAAAV AAGGLQMGGG LPAELYYGGQ FGVTGDGLTL QHQMAKNDQW AADSSLHSML  360
GSVIQTEAEQ EQDSGLQLVH LLLACADFVS KGDQPSALRH LHLLRRVASP LGDSMQRVAS  420
YFADALAARL SLSSNPSSSS SSGAATPRGG AGAGVAPYTF PPSPDTLKIY QILYQACPYV  480
KFAHFTANQA IFEAFHGEDR VHVVDLDILQ GYQWPAFLQA LAARPGGPPT LRLTGVGHPA  540
AAVRETGRHL ASLAASLRVP FEFHAAVADR LERLRPAALQ RRVGEALAVN AVNRLHRVPG  600
VHLGPLLSMI RDQAPKIMTL VEQEAGHNGP YFLGRFLEAL HYYSAIFDSL DATFPADSAP  660
RLKVEQCLLA PEIRNVVACE GAERIARHER LDRWRRLMEG RGFEPVPLSP AAVGQSQVLL  720
GLYGAGDGYR LTEDKGCLLL GWQDRAIIAA SAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-563787544375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980521.10.0PREDICTED: DELLA protein GAI-like
TrEMBLK3ZM940.0K3ZM94_SETIT; Uncharacterized protein
STRINGSi027708m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.15e-95RGA-like 1